PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009617199.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 168aa    MW: 18772.4 Da    PI: 10.3777
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009617199.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.21e-3187143158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep++VNaKQy++Il+RR++Rak+e ekkl +k rkpylheSRh+hAl+R+R+sgGrF
  XP_009617199.1  87 QEPVFVNAKQYHGILRRRESRAKAELEKKL-IKVRKPYLHESRHQHALKRARASGGRF 143
                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-3485146IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.02786146IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.1E-2788143IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.4E-2389111IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS00686091111IPR018362CCAAT-binding factor, conserved site
PRINTSPR006165.4E-23120143IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MRSHDGERSY PQVQNLQPVA STIPPKGDGS QTQPRQLELV THSIACAPNL YADPYYGGMM  60
TPFGQPMVPH VLDMHHLRMP LPHEMAQEPV FVNAKQYHGI LRRRESRAKA ELEKKLIKVR  120
KPYLHESRHQ HALKRARASG GRFAKKSNTD TSKGTCSGSG SNPDLSAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A9e-1987151266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2459772e-61AC245977.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone sle-58j6 map 1, complete sequence.
GenBankAC2461062e-61AC246106.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-9i12 map 1, complete sequence.
GenBankAC2466232e-61AC246623.5 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-36c24 map 1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009617199.11e-124PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
SwissprotQ945M97e-47NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
SwissprotQ9LXV56e-47NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A0V0HY243e-89A0A0V0HY24_SOLCH; Putative nuclear transcription factor Y subunit A-1-like
TrEMBLM1AQ623e-89M1AQ62_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000277857e-89(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.43e-48nuclear factor Y, subunit A1